PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00278.1_g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 309aa    MW: 35160.9 Da    PI: 5.2299
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00278.1_g00007.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.83.4e-151663148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             rg+W++ Ed+ l+  ++++G ++W++ ++  g+ R++k+c++rw +yl
  Rsa1.0_00278.1_g00007.1 16 RGPWSPKEDLTLITFIQKHGHHNWRSLPKLAGLMRCGKSCRLRWINYL 63
                             89********************************************97 PP

2Myb_DNA-binding48.81.6e-1569114148
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                              rg++++eE+  ++++++ lG++ W++Ia++++ gRt++++k+ w+++l
  Rsa1.0_00278.1_g00007.1  69 RGNFSKEEEGAIIHLHQTLGNK-WSKIASYLP-GRTDNEIKNVWNTHL 114
                              89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.8E-23766IPR009057Homeodomain-like
PROSITE profilePS5129413.9471163IPR017930Myb domain
SuperFamilySSF466891.06E-2914110IPR009057Homeodomain-like
SMARTSM007172.3E-111565IPR001005SANT/Myb domain
PfamPF002491.8E-141663IPR001005SANT/Myb domain
CDDcd001671.29E-91863No hitNo description
PROSITE profilePS5129423.81264118IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-2667118IPR009057Homeodomain-like
SMARTSM007171.5E-1368116IPR001005SANT/Myb domain
PfamPF002492.4E-1469114IPR001005SANT/Myb domain
CDDcd001677.20E-1071114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009866Biological Processinduced systemic resistance, ethylene mediated signaling pathway
GO:0071281Biological Processcellular response to iron ion
GO:0071732Biological Processcellular response to nitric oxide
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGKGRAPCCD QSEVKRGPWS PKEDLTLITF IQKHGHHNWR SLPKLAGLMR CGKSCRLRWI  60
NYLRPDVKRG NFSKEEEGAI IHLHQTLGNK WSKIASYLPG RTDNEIKNVW NTHLKKRLFP  120
NSSRSSSYSS ISCPQDRTTE ANQNKNYAVV QEEGNSRDNE SQDSPSSSHL HGKNMHKKPE  180
LHEANELQEI QLLLDLDDFD DTSAFLQTTE TLLPVQPLDS LLQTHTLTGF HNTGGATQEA  240
TELQPFDHSQ PEIPCGFEET NGEFDLWSQL VESNSPTPSP TSEEFDEWLS FMDNQTYFDD  300
FTLLGEVCL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A7e-26131181105MYB PROTO-ONCOGENE PROTEIN
1h8a_C1e-251311824128MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009106799.10.0PREDICTED: myb-related protein 308
TrEMBLM4EPU10.0M4EPU1_BRARP; Uncharacterized protein
STRINGBra030812.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56160.11e-130myb domain protein 72